From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.
|
Synonyms: big dyn
Compound class:
Endogenous peptide in human, mouse or rat
Species: Human, Mouse, Rat
|
|
|||||||||||||||||
Peptide Sequence ![]() |
|
| YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT | |
| Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr | |
Download 2D Structure ![]() |
|
| Canonical SMILES | Download |
| Isomeric SMILES | Download |
| InChI standard identifier | Download |
| InChI standard key | Download |
Molecular structure representations generated using Open Babel