GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

gastrin-34   Click here for help

GtoPdb Ligand ID: 3564

Synonyms: big gastrin (rat)
Species: Rat
Peptide Sequence Click here for help
XLGPQGPQHFIADLSKKQRPPMEEEEEAYGWMDF
pGlu-Leu-Gly-Pro-Gln-Gly-Pro-Gln-His-Phe-Ile-Ala-Asp-Leu-Ser-Lys-Lys-Gln-Arg-Pro-Pro-Met-Glu-Glu-Glu-Glu-Glu-Ala-Tys-Gly-Trp-Met-Asp-Phe-NH2
Post-translational Modification
The N-terminal glutamic acid is cyclated into pyroglutamic acid (represented by pGlu and X), the tyrosine residue at position 29 is sulfated (represented by Tys) and the C-terminal phenylalanine is amidated.