GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
| 
                               
                            
                                
                                                                Synonyms: big gastrin (mouse)
                                 
                                                         
                            Compound class: 
                                                            Endogenous peptide in human, mouse or rat
                                 
                                
                                    Species: Mouse
                                 
                            
                            
                          
                                
                                    
                                
                          
                                   
                                   
                                  
                                    
                                    
                                     | 
                                    
Peptide Sequence ![]()  | 
                                                                |
| XLGLQGPQHFIADLSKKERPRMEEEEEAYGWMDF | |
| pGlu-Leu-Gly-Leu-Gln-Gly-Pro-Gln-His-Phe-Ile-Ala-Asp-Leu-Ser-Lys-Lys-Glu-Arg-Pro-Arg-Met-Glu-Glu-Glu-Glu-Glu-Ala-Tys-Gly-Trp-Met-Asp-Phe-NH2 | |
| Post-translational Modification | |
| The N-terminal glutamic acid cyclizes into pyroglutamic acid (represented by pGlu and X); the tyrosine residue at position 29 is sulfated (Tys) and the C-terminal phenylalanine is amidated. | |