GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Compound class:
Endogenous peptide in human, mouse or rat
Species: Rat
|
Peptide Sequence ![]() |
|
KAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDF | |
Lys-Ala-Pro-Ser-Gly-Arg-Met-Ser-Val-Leu-Lys-Asn-Leu-Gln-Gly-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-Tys-Met-Gly-Trp-Met-Asp-Phe-NH2 |
Post-translational Modification | |
The C-terminal phenylalanine is amidated and the tyrosine residue at position 27 is sulfated, as indicated by Tys which represents Tyr(SO3H). |