insulin-like growth factor 1   Click here for help

GtoPdb Ligand ID: 2495

Abbreviated name: IGF1
Synonyms: somatomedin
Comment: The mouse sequence differs from the rat sequence at residue number 69 (serine in rat, alanine in mouse)
Species: Mouse
Peptide Sequence Click here for help
GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
Gly-Pro-Glu-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Pro-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ile-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Thr-Lys-Ala-Ala
Post-translational Modification
Disulphide bonds are formed between cysteine residues at positions 6 and 48, 18 and 61 and 47 and 52