leiurotoxin I   Click here for help

GtoPdb Ligand ID: 2316

Synonyms: Leiurotoxin-1 (LeTx1) | potassium channel toxin α-KTx 5.1 | scyllatoxin (ScyTx)
Compound class: Peptide
Comment: From Leiurus quinquestriatus hebraeus (Yellow scorpion)
Click here for help
Peptide Sequence Click here for help
AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH
Ala-Phe-Cys-Asn-Leu-Arg-Met-Cys-Gln-Leu-Ser-Cys-Arg-Ser-Leu-Gly-Leu-Leu-Gly-Lys-Cys-Ile-Gly-Asp-Lys-Cys-Glu-Cys-Val-Lys-His-NH2
Post-translational Modification
C-terminal histidine residue undergoes amidation; disulphide bond formation between cysteine residues at positions 3 and 21, 8 and 26, and 12 and 28.