toxin BmP09   Click here for help

GtoPdb Ligand ID: 2306

Synonyms: B. martensi Karsch toxin | beta-toxin BmKAs1 | BmK activator of skeletal-muscle ryanodine receptor
Compound class: Peptide
Comment: From the venom of Buthus martensii
Click here for help
Peptide Sequence Click here for help
DNGYLLNKYTGCKIWCVINNESCNSECKLRRGNYGYCYFWKLACYCEGAPKSELWAYETNKCNGKM
Asp-Asn-Gly-Tyr-Leu-Leu-Asn-Lys-Tyr-Thr-Gly-Cys-Lys-Ile-Trp-Cys-Val-Ile-Asn-Asn-Glu-Ser-Cys-Asn-Ser-Glu-Cys-Lys-Leu-Arg-Arg-Gly-Asn-Tyr-Gly-Tyr-Cys-Tyr-Phe-Trp-Lys-Leu-Ala-Cys-Tyr-Cys-Glu-Gly-Ala-Pro-Lys-Ser-Glu-Leu-Trp-Ala-Tyr-Glu-Thr-Asn-Lys-Cys-Asn-Gly-Lys-Met
Post-translational Modification
Disulphide bonds between cysteine residues at positions 12 and 62, 16 and 37, 23 and 44, and 27 and 46