GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

prokineticin-2β   Click here for help

GtoPdb Ligand ID: 1868

Abbreviated name: PK2β
Comment: Prokineticin-2β is 21 amino acids shorter than the parent peptide. This shorter variant is believed to arise as the result of post-translational protein cleavage events. Prokineticin-2β has been identified in human, rat and mouse [1].
Species: Human
Click here for help
Peptide Sequence Click here for help
AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQ
K
Ala-Val-Ile-Thr-Gly-Ala-Cys-Asp-Lys-Asp-Ser-Gln-Cys-Gly-Gly-Gly-Met-Cys-Cys-Ala-Val-Ser-Ile-Trp-Val-Lys-Ser-Ile-Arg-Ile-Cys-Thr-Pro-Met-Gly-Lys-Leu-Gly-Asp-Ser-Cys-His-Pro-Leu-Thr-Arg-Lys-Val-Pro-Phe-Phe-Gly-Arg-Arg-Met-His-His-Thr-Cys-Pro-Cys-Leu-Pro-Gly-Leu-Ala-Cys-Leu-Arg-Thr-Ser-Phe-Asn-Arg-Phe-Ile-Cys-Leu-Ala-Gln-Lys