GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

annexin A3   Click here for help

GtoPdb Ligand ID: 13777

Synonyms: annexin III | calcimedin 35-alpha | inositol 1,2-cyclic phosphate 2-phosphohydrolase (EC 3.1.4.43) | lipocortin III | placental anticoagulant protein III
Comment: Annexin A3 (ANXA3) is one member of a family of intracellular calcium-dependent phospholipid-binding proteins (13 genes in humans). It regulates cellular growth and signal transduction pathways via inhibition of phopholipase A2. This activity modulates the conversion of inositol 1,2-cyclic phosphate to inositol 1-phosphate.
Pathogenic effects of ANXA3 have been reported in the development of cancers [2,4], in particular triple-negative breast cancer (TNBC) [5]. Pharmacological modulation of ANXA3 is therefore of interest for the development of TNBC therapeutics.
Species: Human
Peptide Sequence Click here for help
MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKDDLKGDLSGHF
EHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLA
DGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLL
LAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICG
GDD