acyl-CoA-binding protein   Click here for help

GtoPdb Ligand ID: 13696

Synonyms: endozepine [6]
Comment: Diazepam binding inhibitor/Acyl-CoA-binding protein (ACBP) an a 11kD peptide with multiple biological actions [1,3,5]. It is reported to bind to thiol esters of long fatty acids and coenzyme A. It also displaces diazepam from the benzodiazepine binding domain of type A gamma-aminobutyric acid GABAA receptors [2,4], which suggests that it may act as an allosteric GABAA modulator.
Species: Human
Peptide Sequence Click here for help
MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEE
LKKKYGI