GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CART(55-102)   Click here for help

GtoPdb Ligand ID: 13185

Comment: A fragment of human cocaine and amphetamine regulated transcript (CARTPT). The peptide sequence is identical in rat CARTPT.
Species: Human
Peptide Sequence Click here for help
VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu
Chemical Modification
3 disulphide bonds as annotated.