GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

glucagon-like peptide 1-(7-36) amide   Click here for help

GtoPdb Ligand ID: 1132

Synonyms: GLP-1(7-36)amide
Comment: The sequence is identical in human, rat and mouse.
Species: Human, Mouse, Rat
Click here for help
Peptide Sequence Click here for help
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Post-translational Modification
The C-terminal arginine is amidated. GLP-1 (7-36) amide is a N-terminally truncated fragment of GLP1 [1,3]. GLP-1 (7-36) amide is the more predominant fragment of the precursor