GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
| Compound class: 
                                                            Endogenous peptide in human, mouse or rat
                                 
                                    
                                        Comment: Plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. Required for normal ossification and bone development. Stimulates hepatic and intestinal proliferation.
                                    
                                 
                                    Species: Human
                                 | 
| Peptide Sequence  | |
| EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFY LCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQK PFKYTTVTKRSRRIRPTHPA | |
| Selected 3D Structures | ||
| 
 | ||
| Post-translational Modification | |
| Disulphide bond between Cys109 and Cys127. | |