GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: Kayshild® | NN-9535 | NN9535 | NNC0480 0389 | Ozempic® (injectable semaglutide) | Rybelsus® (oral semaglutide) | Wegovy®
semaglutide is an approved drug (FDA (2017), EMA (2018))
Compound class:
Peptide
Comment: Semaglutide is a glucagon like peptide 1 (GLP-1) receptor peptidomimetic agonist [9]. Structurally it is a modified analogue of glucagon-like peptide 1-(7-37) with amino acids at positions 8 and 34 replaced by α-aminobutyric acid and arginine respectively, and Lys26 is acylated with stearic diacid. Semaglutide has slightly lower GLP-1 receptor affinity than liraglutide, but this is compensated by an increased serum albumin affinity, which ensures improved resistance to metabolic degradation.
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
|
|||||||||||||||||
Peptide Sequence ![]() |
|
| HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG | |
| H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly-OH | |
Download 2D Structure ![]() |
|
| Canonical SMILES | Download |
| Isomeric SMILES | Download |
| InChI standard identifier | Download |
| InChI standard key | Download |
Molecular structure representations generated using Open Babel