From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

H. polygyrus TGF-β mimic   Click here for help

GtoPdb Ligand ID: 9713

Synonyms: Hp-TGM
Immunopharmacology Ligand
Compound class: Peptide
Comment: Hp-TGM is a fully functional mimic of the mammalian pro-tolerogenic cytokine TGF-β that is secreted by the intestinal helminth parasite Heligmosomoides polygyrus [1]. Hp-TGM replicates the receptor interaction, downstream signalling and anti-inflammatory activity (by activating host immunosuppressive regulatory T cells) of TGF-β, despite sharing no structural homology with the host cytokine. The activity profile of this peptide suggests potential for therapeutic application. The cDNA sequence for Hp-TGM is submitted to NCBI with accession MG099712.
Click here for help
Peptide Sequence Click here for help
MLLTVVIGLLEVAATDDSGCMPFSDEAATYKYVAKGPKNIEIPAQIDNSGMYPDYTHVKRFCKGLHGEDTTGWFVGICLA
SQWYYYEGVQECDDRRCSPLPTNDTVSFEYLKATVNPGIIFNITVHPDASGKYPELTYIKRICKNFPTDSNVQGHIIGMC
YNAEWQFSSTPTCPASGCPPLPDDGIVFYEYYGYAGDRHTVGPVVTKDSSGNYPSPTHARRRCRALSQEADPGEFVAICY
KSGTTGESHWEYYKNIGKCPDPRCKPLEANESVHYEYFTMTNETDKKKGPPAKVGKSGKYPEHTCVKKVCSKWPYTCSTG
GPIFGECIGATWNFTALMECINARGCSSDDLFDKLGFEKVIVRKGEGSDSYKDDFARFYATGSKVIAECGGKTVRLECSN
GEWHEPGTKTVHRCTKDGIRTL