From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

CCK-58   Click here for help

GtoPdb Ligand ID: 862

Compound class: Peptide
Species: Dog
Click here for help
Peptide Sequence Click here for help
AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDF
Ala-Val-Gln-Lys-Val-Asp-Gly-Glu-Pro-Arg-Ala-His-Leu-Gly-Ala-Leu-Leu-Ala-Arg-Tyr-Ile-Gln-Gln-Ala-Arg-Lys-Ala-Pro-Ser-Gly-Arg-Met-Ser-Val-Ile-Lys-Asn-Leu-Gln-Asn-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-Tys-Met-Gly-Trp-Met-Asp-Phe-NH2
Post-translational Modification
Tyrosine residue at position 52 is sulphated (Tys); C-terminal phenylalanine residue is amidated