[125I]KC-Tyr   Click here for help

GtoPdb Ligand ID: 832

 Ligand is labelled  Ligand is radioactive
Compound class: Peptide
Comment: Synthetic radiolabelled analogue of the mouse KC (CXCL1)
Click here for help
Peptide Sequence Click here for help
AYIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Ala-Tyr-Ile-Ala-Asn-Glu-Leu-Arg-Cys-Gln-Cys-Leu-Gln-Thr-Met-Ala-Gly-Ile-His-Leu-Lys-Asn-Ile-Gln-Ser-Leu-Lys-Val-Leu-Pro-Ser-Gly-Pro-His-Cys-Thr-Gln-Thr-Glu-Val-Ile-Ala-Thr-Leu-Lys-Asn-Gly-Arg-Glu-Ala-Cys-Leu-Asp-Pro-Glu-Ala-Pro-Leu-Val-Gln-Lys-Ile-Val-Gln-Lys-Met-Leu-Lys-Gly-Val-Pro-Lys
Chemical Modification
The protein is mutagenised to inlcude the radiolabelleed tyrosine residue at position 2, in place of proline