MC148R   Click here for help

GtoPdb Ligand ID: 778

Synonyms: MC 148 | MC 148 CC chemokine
Compound class: Peptide
Comment: A viral chemokine from Molluscum contagiosum virus. The peptide appears to exist in two forms MC148R1 and MC148R2 [2]. The sequence provided here is for MC148R2, which has GenBank protein accession number AAB72041. MC148R1 has peptide sequence MRGGDVFASV VLMLLLALPR PGVSLARRKC CLNPTNRPIP NPLLQDLSRV DYQAIGHDCG REAFRVTLQD GRQCVSVGNK SLLDWLRGHK DLCPPQIWSG CESL [2].
Click here for help
Peptide Sequence Click here for help
MRARAVFASVVLTLLLALPRPGVSLSRRKCCLNPTNRPIPNPLLQDLDKVDYQPMGHDCGREAFRVTLQDGRQCVSVGNQ
SLLDWLKGHKDLCPRMWPGCESL