GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

SsmTx-1   Click here for help

GtoPdb Ligand ID: 7764

Compound class: Peptide
Comment: From the venom of Scolopendra subspinipes mutilans (Chinese red-headed centipede). N.B. UniProt does not include an entry for this peptide.
Click here for help
Peptide Sequence Click here for help
EESMLLSCPDLSCPTGYTCDVLTKKCKRLSDELWDH
Glu-Glu-Ser-Met-Leu-Leu-Ser-Cys-Pro-Asp-Leu-Ser-Cys-Pro-Thr-Gly-Tyr-Thr-Cys-Asp-Val-Leu-Thr-Lys-Lys-Cys-Lys-Arg-Leu-Ser-Asp-Glu-Leu-Trp-Asp-His