From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

andexanet alfa   Click here for help

GtoPdb Ligand ID: 7576

Synonyms: Andexxa® | coagulation factor Xa (recombinant), inactivated-zhzo | Ondexxya® | PRT064445 | PRT4445 | r-antidote
Approved drug
andexanet alfa is an approved drug (FDA (2018), EMA (2019))
Compound class: Peptide
Comment: Andexanet alfa is a recombinant modified human Factor Xa (FXa) protein that acts as a mimetic of endogenous human factor Xa, and which was developed as a universal antidote to reverse thhe anticoagulant effects of direct or indirect FXa inhibitors. Information regarding the invention of andexanet alfa is available in patent WO2009042962 [2].
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: andexanet alfa

Peptide Sequence Click here for help
ANSFLFWNKYKDGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFCHEEQNSVVCSCARG
YTLADNGKACIPTGPYPCGKQTLERRKRRKRIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKR
FKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGIVSG
FGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYDTKQEDACQGDAGGPHVTRFKDTYFVTGIVSWGEGC
ARKGKYGIYTKVTAFLKWIDRSMKTRGLPKAKSHAPEVITSSPLK
Chemical Modification
The hexapeptide RKRRKR is used to link the modified light and heavy chains of human factor X to generate the recombinant r-antidote peptide [1].