From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

ρ-Da1a   Click here for help

GtoPdb Ligand ID: 6663

Synonyms: toxin AdTx1
Compound class: Peptide
Comment: A 65 amino acid peptide isolated from green mamba venom, and subsequently chemically synthesized [2].
Click here for help
Peptide Sequence Click here for help
LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDSIHCCKTDKCNE
Leu-Thr-Cys-Val-Thr-Ser-Lys-Ser-Ile-Phe-Gly-Ile-Thr-Thr-Glu-Asp-Cys-Pro-Asp-Gly-Gln-Asn-Leu-Cys-Phe-Lys-Arg-Arg-His-Tyr-Val-Val-Pro-Lys-Ile-Tyr-Asp-Ser-Thr-Arg-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ile-Pro-Glu-Asn-Tyr-Asp-Ser-Ile-His-Cys-Cys-Lys-Thr-Asp-Lys-Cys-Asn-Glu
Post-translational Modification
Disulphide bridges between cys 3-24, 17-42, 46-57, 58-63 create a three-finger-fold peptide.