GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[His4, Tyr5, Trp6, His7]TIP39 (human)   Click here for help

GtoPdb Ligand ID: 5572

Synonyms: [His4, Tyr5, Trp6, His7]-hTIP39 | [His4, Tyr5, Trp6, His7]-TIP39 (human) | HYWH-TIP39
Compound class: Peptide
Comment: Synthetic analogue of human TIP39
Click here for help
Peptide Sequence Click here for help
SLAHYWHAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Ser-Leu-Ala-His-Tyr-Trp-His-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro
Chemical Modification
Leucine 4 of the natural sequence of TIP39 is replaced by histidine; alanine 5 by tyrosine, aspartic acid resdiues 6 and 7 by tryptophan and histidine respectively