vanillotoxin-2   Click here for help

GtoPdb Ligand ID: 5543

Synonyms: tau-theraphotoxin-Pc1b | tau-TRTX-Pc2a | VaTx2
Compound class: Peptide
Comment: From the venom of Psalmopoeus cambridgei (Trinidad chevron tarantula)
Click here for help
Peptide Sequence Click here for help
GACRWFLGGCKSTSDCCEHLSCKMGLDYCAWDGTF
Gly-Ala-Cys-Arg-Trp-Phe-Leu-Gly-Gly-Cys-Lys-Ser-Thr-Ser-Asp-Cys-Cys-Glu-His-Leu-Ser-Cys-Lys-Met-Gly-Leu-Asp-Tyr-Cys-Ala-Trp-Asp-Gly-Thr-Phe-NH2
Post-translational Modification
C-terminal phenylalanine is amidated; predicted disulphide bond formation between cysteine residues at positions 3 and 17, 10 and 22, and 16 and 29