FSH α subunit-deglycosylated form   Click here for help

GtoPdb Ligand ID: 5536

Compound class: Peptide
Comment: Synthetic analogue of the glycoprotein hormone common alpha subunit, one of the subunit components of the the synthetic FSH analogue FSH deglycosylated α/β
Is a component of
Peptide Sequence Click here for help
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKQVTSESTCCVAKSYNRVTVMGGFKVEQHT
ACHCSTCYYHKS
Chemical Modification
Asparagine residues at positions 52 and 78 of the natural sequence which undergo glycosylation in the formation of active FSH are replaced by glutamine residues