GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: Forsteo® | Forteo® | PTH-(1-34) (human)
teriparatide is an approved drug (FDA (1987), EMA (2003))
Compound class:
Peptide
Comment: Teriparatide is a synthetic peptide of amino acids 1-34 of the N-terminal of human parathyroid hormone (PTH). The PubChem and ChEMBL entries linked to above both display a chemical structure for teriparatide. Compare this to the clinical candidate peptide abaloparatide which is a synthetic analogue of human parathyroid hormone-related protein (PTHrP) [1].
Teriparatide biosimilars and non-originator biologicals are available in countries where patents have already expired. The patents on the reference agent Forteo/Forsteo expire in the US and in Europe in August 2019. The table below lists teriparatide biosimilars that are already approved or are in development.
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Peptide Sequence ![]() |
|
| SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF | |
| H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH | |
HELM Notation ![]() |
|
| PEPTIDE1{S.V.S.E.I.Q.L.M.H.N.L.G.K.H.L.N.S.M.E.R.V.E.W.L.R.K.K.L.Q.D.V.H.N.F}$$$$ | |
Download 2D Structure ![]() |
|
| Canonical SMILES | Download |
| Isomeric SMILES | Download |
| InChI standard identifier | Download |
| InChI standard key | Download |
Molecular structure representations generated using Open Babel