Compound class:
Peptide
Species: Pig
|
Is a component of |
relaxin |
Peptide Sequence ![]() |
|
QSTNDFIKACGRELVRLWVEICGSVSWGRTAL | |
Gln-Ser-Thr-Asn-Asp-Phe-Ile-Lys-Ala-Cys-Gly-Arg-Glu-Leu-Val-Arg-Leu-Trp-Val-Glu-Ile-Cys-Gly-Ser-Val-Ser-Trp-Gly-Arg-Thr-Ala-Leu |
Post-translational Modification | |
Fully active porcine relaxin is a heterodimer of the B chain and the A chain linked by two disulfide bonds, the first between B chain (residue 10) and A chain (residue 145), and the second between B chain (residue 22) and A chain (residue 158). |