SNX482   Click here for help

GtoPdb Ligand ID: 4315

Synonyms: SNX-482 | toxin SNX-482
Compound class: Peptide
Comment: From the venom gland of Hysterocrates gigas (African tarantula)
Click here for help
Peptide Sequence Click here for help
GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Gly-Val-Asp-Lys-Ala-Gly-Cys-Arg-Tyr-Met-Phe-Gly-Gly-Cys-Ser-Val-Asn-Asp-Asp-Cys-Cys-Pro-Arg-Leu-Gly-Cys-His-Ser-Leu-Phe-Ser-Tyr-Cys-Ala-Trp-Asp-Leu-Thr-Phe-Ser-Asp
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 7 and 21, 14 and 26 and 20 and 33