GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

GaTx1   Click here for help

GtoPdb Ligand ID: 4198

Synonyms: Toxin GaTx1
Compound class: Peptide
Comment: From Leiurus quinquestriatus hebraeus (yellow scorpion)
Peptide Sequence Click here for help
CGPCFTTDHQMEQKCAECCGGIGKCYGPQCLCNR
Cys-Gly-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Glu-Gln-Lys-Cys-Ala-Glu-Cys-Cys-Gly-Gly-Ile-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Asn-Arg-NH2
Post-translational Modification
C-terminal arginine residue is arginine amide; predicted disulphide bond formation between cysteine residues at positions 1 and 18, 4 and 25, 15 and 30, and 19 and 32