GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

DkTx   Click here for help

GtoPdb Ligand ID: 4178

Synonyms: Double-knot toxin
Compound class: Peptide
Comment: Toxin from Chilobrachys guangxiensis (Chinese earth tiger tarantula). Analysis of the mechanism of TRPV1 activation by DkTx is reported by Geron et al. [2].
Click here for help
Peptide Sequence Click here for help
DCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTNCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYRGRND
Asp-Cys-Ala-Lys-Glu-Gly-Glu-Val-Cys-Ser-Trp-Gly-Lys-Lys-Cys-Cys-Asp-Leu-Asp-Asn-Phe-Tyr-Cys-Pro-Met-Glu-Phe-Ile-Pro-His-Cys-Lys-Lys-Tyr-Lys-Pro-Tyr-Val-Pro-Val-Thr-Thr-Asn-Cys-Ala-Lys-Glu-Gly-Glu-Val-Cys-Gly-Trp-Gly-Ser-Lys-Cys-Cys-His-Gly-Leu-Asp-Cys-Pro-Leu-Ala-Phe-Ile-Pro-Tyr-Cys-Glu-Lys-Tyr-Arg-Gly-Arg-Asn-Asp