calciseptine   Click here for help

GtoPdb Ligand ID: 4149

Compound class: Peptide
Comment: From the venom gland of Dendroaspis polylepis polylepis (Black mamba)
Click here for help
Peptide Sequence Click here for help
RICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK
Arg-Ile-Cys-Tyr-Ile-His-Lys-Ala-Ser-Leu-Pro-Arg-Ala-Thr-Lys-Thr-Cys-Val-Glu-Asn-Thr-Cys-Tyr-Lys-Met-Phe-Ile-Arg-Thr-Gln-Arg-Glu-Tyr-Ile-Ser-Glu-Arg-Gly-Cys-Gly-Cys-Pro-Thr-Ala-Met-Trp-Pro-Tyr-Gln-Thr-Glu-Cys-Cys-Lys-Gly-Asp-Arg-Cys-Asn-Lys
Post-translational Modification
Disulphide bond formation between cysteine residues at postions 3 and 22, 17 and 39, 41 and 52 and 53 and 58