GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: [125I]-GLP-1(7-37) | [125I]-glucagon-like peptide-1(7-37) | [125I]GLP-1(7-37)
Compound class:
Peptide
|
|
|||||||||||||||||
Peptide Sequence ![]() |
|
| HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG | |
| His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly | |
Download 2D Structure ![]() |
|
| Canonical SMILES | Download |
| Isomeric SMILES | Download |
| InChI standard identifier | Download |
| InChI standard key | Download |
Molecular structure representations generated using Open Babel