muscarinic toxin 1   Click here for help

GtoPdb Ligand ID: 311

Synonyms: MT1 | MTx1
Compound class: Peptide
Comment: From the venom glands of the Eastern green mamba (Dendroaspis angusticeps)
Click here for help
Peptide Sequence Click here for help
LTCVTSKSIFGITTENCPDGQNLCFKKWYYIVPRYSDITWGCAATCPKPTNVRETIRCCETDKCNE
Leu-Thr-Cys-Val-Thr-Ser-Lys-Ser-Ile-Phe-Gly-Ile-Thr-Thr-Glu-Asn-Cys-Pro-Asp-Gly-Gln-Asn-Leu-Cys-Phe-Lys-Lys-Trp-Tyr-Tyr-Ile-Val-Pro-Arg-Tyr-Ser-Asp-Ile-Thr-Trp-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Lys-Pro-Thr-Asn-Val-Arg-Glu-Thr-Ile-Arg-Cys-Cys-Glu-Thr-Asp-Lys-Cys-Asn-Glu
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 3 and 24, 17 and 42, 46 and 58 and 59 and 64