β-scorpion toxin TiTXγ   Click here for help

GtoPdb Ligand ID: 2627

Synonyms: β-mammal/insect toxin Ts7 | Tityustoxin VII | TsTX-VII
Compound class: Peptide
Comment: From Tityus serrulatus (Brazilian scorpion)
Peptide Sequence Click here for help
KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC
Lys-Glu-Gly-Tyr-Leu-Met-Asp-His-Glu-Gly-Cys-Lys-Leu-Ser-Cys-Phe-Ile-Arg-Pro-Ser-Gly-Tyr-Cys-Gly-Arg-Glu-Cys-Gly-Ile-Lys-Lys-Gly-Ser-Ser-Gly-Tyr-Cys-Ala-Trp-Pro-Ala-Cys-Tyr-Cys-Tyr-Gly-Leu-Pro-Asn-Trp-Val-Lys-Val-Trp-Asp-Arg-Ala-Thr-Asn-Lys-Cys-Nh2
Post-translational Modification
C-terminal cysteine residue undergoes amidation; disulphide bond formation between cysteine residues at positions 11 and 61, 15 and 37, 23 and 42, 27 and 44.