β-scorpion toxin Css IV   Click here for help

GtoPdb Ligand ID: 2620

Synonyms: β-mammal toxin Css4 | Css IV
Compound class: Peptide
Comment: From Centruroides suffusus suffusus (Mexican scorpion)
Click here for help
Peptide Sequence Click here for help
KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN
Lys-Glu-Gly-Tyr-Leu-Val-Asn-Ser-Tyr-Thr-Gly-Cys-Lys-Phe-Glu-Cys-Phe-Lys-Leu-Gly-Asp-Asn-Asp-Tyr-Cys-Leu-Arg-Glu-Cys-Arg-Gln-Gln-Tyr-Gly-Lys-Gly-Ser-Gly-Gly-Tyr-Cys-Tyr-Ala-Phe-Gly-Cys-Trp-Cys-Thr-His-Leu-Tyr-Glu-Gln-Ala-Val-Val-Trp-Pro-Leu-Pro-Asn-Lys-Thr-Cys-Asn-NH2
Post-translational Modification
C-terminal asparagine residue is predicted to undergo amidation; predicted disulphide bond formation between cysteine residues at positions 12 and 65, 16 and 41, 25 and 46, and 29 and 48