phrixotoxin 2   Click here for help

GtoPdb Ligand ID: 2583

Synonyms: κ-theraphotoxin-Ps1b | κ-TRTX-Ps1b | PaTX 2 | PaTX2
Compound class: Peptide
Comment: From Paraphysa scrofa (Chilean copper tarantula)
Click here for help
Peptide Sequence Click here for help
YCQKWMWTCDEERKCCEGLVCRLWCKRIINM
Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Glu-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Leu-Val-Cys-Arg-Leu-Trp-Cys-Lys-Arg-Ile-Ile-Asn-Met-NH2
Post-translational Modification
C-terminal methionine residue is predicted to undergo amidation; predicted disulphide bond formation between cysteine residues at positions 2 and 16, 9 and 21, and 15 and 25.