sea anemone toxin BDS-I   Click here for help

GtoPdb Ligand ID: 2578

Synonyms: antihypertensive protein BDS-1 | blood depressing substance 1 (BDS-1)
Compound class: Peptide
Comment: From Anemonia sulcata (Mediterranean snakelocks sea anemone)
Click here for help
Peptide Sequence Click here for help
AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH
Ala-Ala-Pro-Cys-Phe-Cys-Ser-Gly-Lys-Pro-Gly-Arg-Gly-Asp-Leu-Trp-Ile-Leu-Arg-Gly-Thr-Cys-Pro-Gly-Gly-Tyr-Gly-Tyr-Thr-Ser-Asn-Cys-Tyr-Lys-Trp-Pro-Asn-Ile-Cys-Cys-Tyr-Pro-His
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 4 and 39, 6 and 32, and 22 and 40