GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ScTx1   Click here for help

GtoPdb Ligand ID: 2576

Synonyms: κ-theraphotoxin-Sc1a | κ-TRTX-Sc1a | stromatoxin-1
Compound class: Peptide
Comment: From Stromatopelma calceatum (Featherleg baboon tarantula)
Click here for help
Peptide Sequence Click here for help
DCTRMFGACRRDSDCCPHLGCKPTSKYCAWDGTI
Asp-Cys-Thr-Arg-Met-Phe-Gly-Ala-Cys-Arg-Arg-Asp-Ser-Asp-Cys-Cys-Pro-His-Leu-Gly-Cys-Lys-Pro-Thr-Ser-Lys-Tyr-Cys-Ala-Trp-Asp-Gly-Thr-Ile-NH2
Post-translational Modification
C-terminal isoleucine undergoes amidation; predicted disulphide bond formation between cysteine residues at positions 2 and 16, 9 and 21, and 15 and 28.