jingzhaotoxin-XI   Click here for help

GtoPdb Ligand ID: 2575

Synonyms: κ-theraphotoxin-Cj1a | κ-TRTX-Cj1a | Jingzhaotoxin-11 | JZTX-11 | JZTX-XI
Compound class: Peptide
Comment: From Chilobrachys jingzhao (Chinese earth tiger tarantula)
Click here for help
Peptide Sequence Click here for help
ECRKMFGGCSVDSDCCAHLGCKPTLKYCAWDGTF
Glu-Cys-Arg-Lys-Met-Phe-Gly-Gly-Cys-Ser-Val-Asp-Ser-Asp-Cys-Cys-Ala-His-Leu-Gly-Cys-Lys-Pro-Thr-Leu-Lys-Tyr-Cys-Ala-Trp-Asp-Gly-Thr-Phe-NH2
Post-translational Modification
C-terminal phenylalanine residue undergoes amidation; disulphide bond formation between cysteine residues at positions 2 and 16, 9 and 21, and 15 and 28.