GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[Trp23]PTHrP-(1-36) (human)   Click here for help

GtoPdb Ligand ID: 1809

Compound class: Peptide
Comment: Synthetic analogue of human PTHrP
Click here for help
Peptide Sequence Click here for help
AVSEHQLLHDKGKSIQDLRRRFWLHHLIAEIHTAEI
Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Trp-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile
Chemical Modification
Phenyalalanine residue at position 23 of the natural sequence is replaced by tryptophan