GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[Phe23]PTH-(1-34) (human)   Click here for help

GtoPdb Ligand ID: 1807

Compound class: Peptide
Comment: Synthetic analogue of human PTH
Click here for help
Peptide Sequence Click here for help
SVSEIQLMHNLGKHLNSMERVEFLRKKLQDVHNF
Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Phe-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
Chemical Modification
Tryptophan residue at position 23 of the natural sequence is replaced by phenylalanine