[Ile31,Gln34]PP (human)   Click here for help

GtoPdb Ligand ID: 1555

Synonyms: [Ile31,Gln34]-PP (human) | human [Ile31,Gln34] pancreatic peptide
Compound class: Peptide
Comment: Synthetic analogue of human pancreatic polypeptide
Click here for help
Peptide Sequence Click here for help
APLEPVYPGDNATPEQMAQYAADLRRYINMITRQRY
Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Chemical Modification
Leucine residue at position 31 of the natural sequence is isoleucine, proline residue at position 34 is replaced by glutamine