GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

sonefpeglutide   Click here for help

GtoPdb Ligand ID: 14554

Compound class: Peptide
Comment: Sonefpeglutide (HM15912) is a long-acting glucagon-like peptide 2 (GLP-2) peptide analogue. Amino acid sequences for hGLP-2 and the analogue GT15912 used in sonefpeglutide are compared in [1], and shown below.
hGLP-2 HADGSFSDEMNTILDNLAARDFINWLIQTKITD-OH
GT15912 HGDGSFSDEMNTILDNLAARDFINWLIQTRITDK-OH
Structurally sonefpeglutide is a fusion protein of the GLP-2 analogue (with an additional C-terminal lysine/K) and a dimeric IgG4 Fc domain, joined by a polyethylene glycol (PEG) linker at H.
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
No information available.
Summary of Clinical Use Click here for help
Sonefpeglutide (HM15912) was progressed as a clinical candidate for the treatment of short bowel syndrome.
Clinical Trials
Clinical Trial ID Title Type Source Comment References
NCT04076293 Single Ascending Dose Study to Assess Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of HM15912(Sonefpeglutide) in Healthy Korean Subjects Phase 1 Interventional Hanmi Pharmaceutical Company Limited
NCT04775706 Phase 2 Study to Assess the Safety, PK, and PD of Sonefpeglutide (HM15912) in SBS-IF Subjects Phase 2 Interventional Hanmi Pharmaceutical Company Limited