GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Compound class:
Peptide
Comment: Sonefpeglutide (HM15912) is a long-acting glucagon-like peptide 2 (GLP-2) peptide analogue. Amino acid sequences for hGLP-2 and the analogue GT15912 used in sonefpeglutide are compared in [1], and shown below.
hGLP-2 HADGSFSDEMNTILDNLAARDFINWLIQTKITD-OH GT15912 HGDGSFSDEMNTILDNLAARDFINWLIQTRITDK-OH Structurally sonefpeglutide is a fusion protein of the GLP-2 analogue (with an additional C-terminal lysine/K) and a dimeric IgG4 Fc domain, joined by a polyethylene glycol (PEG) linker at H. Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
| No information available. |
Summary of Clinical Use ![]() |
| Sonefpeglutide (HM15912) was progressed as a clinical candidate for the treatment of short bowel syndrome. |
| Clinical Trials | |||||
| Clinical Trial ID | Title | Type | Source | Comment | References |
| NCT04076293 | Single Ascending Dose Study to Assess Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of HM15912(Sonefpeglutide) in Healthy Korean Subjects | Phase 1 Interventional | Hanmi Pharmaceutical Company Limited | ||
| NCT04775706 | Phase 2 Study to Assess the Safety, PK, and PD of Sonefpeglutide (HM15912) in SBS-IF Subjects | Phase 2 Interventional | Hanmi Pharmaceutical Company Limited | ||