GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

sonefpeglutide   Click here for help

GtoPdb Ligand ID: 14554

Compound class: Peptide
Comment: Sonefpeglutide (HM15912) is a long-acting glucagon-like peptide 2 (GLP-2) peptide analogue. Amino acid sequences for hGLP-2 and the analogue GT15912 used in sonefpeglutide are compared in [1], and shown below.
hGLP-2 HADGSFSDEMNTILDNLAARDFINWLIQTKITD-OH
GT15912 HGDGSFSDEMNTILDNLAARDFINWLIQTRITDK-OH
Structurally sonefpeglutide is a fusion protein of the GLP-2 analogue (with an additional C-terminal lysine/K) and a dimeric IgG4 Fc domain, joined by a polyethylene glycol (PEG) linker at H.
Click here for help
Classification Click here for help
Compound class Peptide
Database Links Click here for help
Specialist databases
IMGT/mAb-DB 1626
Other databases
CAS Registry No. 2854391-99-2 (source: WHO INN record)
ChEMBL Ligand CHEMBL6068175
GtoPdb PubChem SID 528429875