GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

eneboparatide   Click here for help

GtoPdb Ligand ID: 13815

Synonyms: AZP-3601 | AZP3601 | LA-PTH [2]
Compound class: Peptide
Comment: Eneboparatide (AZP-3601) is a synthetic long-acting PTH receptor 1 agonist [1-2]. It is a fusion of modified PTH(1-14) with amino acid substitutions and PTHrP(15-36). Compared to native human PTH, amino acid substitution in the PTH region of eneboparatide are S3>A, H5>I, L8>M, D10>Q, K11>R, G12>A, S14>W,L18>A, F22>A, H26>K Eneboparatide associates more potently with the R0 conformation of PTH1R (in the presence of 125I-PTH(1-34) and GTPγS to block receptor-G protein-coupling, compared to PTH(1-34) or PTH(1-84) [2]. All three peptides interact with the RG (G protein-coupled) conformation of PTH1R with similar potencies.
Click here for help
Peptide Sequence Click here for help
AVAEIQLMHQRAKWIQDARRRAFLHKLIAEIHTAEI
Ala-Val-Ala-Glu-Ile-Gln-Leu-Met-His-Gln-Arg-Ala-Lys-Trp-Ile-Gln-Asp-Ala-Arg-Arg-Arg-Ala-Phe-Leu-His-Lys-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile