GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

palopegteriparatide   Click here for help

GtoPdb Ligand ID: 13484

Synonyms: mPEG-PTH (1-34) | TransCon PTH | Yorvipath®
Approved drug
palopegteriparatide is an approved drug (EMA (2023), FDA (2024))
Compound class: Peptide
Comment: Palopegteriparatide is a synthetic parathyroid hormone mimetic prodrug. Structurally it is an N-terminally PEGylated fragment of amino acids 1-34 of the mature human peptide (84 aa) [1]. Palopegteriparatide is inactive at the PTH receptor until the peptide-PEG linker is cleaved, releasing the active PTH(1-34) peptide.
Peptide Sequence Click here for help
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
Chemical Modification
Conjugated at the N-terminal amino group (via a cleavable linker) to O-methylpolyethylene glycol (2 x 20 kDa mPEG)