GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

somatrogon   Click here for help

GtoPdb Ligand ID: 12013

Synonyms: hGH-CTP | MOD-4023 | MOD4023 | Ngenla® | somatrogon-ghla
Approved drug
somatrogon is an approved drug (EMA (2022), FDA (2023))
Compound class: Peptide
Comment: Somatrogon is a recombinant chimeric protein that contains the amino acid sequence of human growth hormone (hGH) and three copies of the 28 aa carboxy-terminal peptide (CTP) from human chorionic gonadotropin (CTP-hGH-CTP-CTP). It acts as a long-acting growth hormone replacement with pharmacokinetics that support once-weekly administration [2].
Click here for help
Peptide Sequence Click here for help
NREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQT
YSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFSSSSKAPPPSLPSPSRLPGPSDTPILPQSSS
SKAPPPSLPSPSRLPGPSDTPILPQ