nogapendekin alfa   Click here for help

GtoPdb Ligand ID: 11594

Synonyms: IL15 D72
Compound class: Peptide
Comment: Inogapendekin alfa is recombinant human IL-15 with an amino acid substitution (Asn72Asp/N72D) that enhances its agonist activity at the IL-15Rβγc complex. IL-15N72D increases biological activity by 4-5-fold compared to the wild type cytokine. Inogapendekin alfa is synthesised in tandem with inbakicept to generate the clinical stage IL-15 superagonist complex ALT-803.
Peptide Sequence Click here for help
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNV
TESGCKECEELEEKNIKEFLQSFVHIVQMFINTS