bempegaldesleukin   Click here for help

GtoPdb Ligand ID: 10659

Synonyms: NKTR-214 | NKTR214
Immunopharmacology Ligand
Compound class: Peptide
Comment: Bempegaldesleukin (NKTR-214) is an engineered variant of human interleukin-2 [4] in which Ala1 has been removed and Cys125 is substituted by Ser. The peptide is produced in E. coli and an average of 6 lysine residues are N6 substituted with [(2,7-bis{[methylpoly(oxyethylene)]carbamoyl}-9H-fluoren-9-yl)methoxy]carbonyl (PEG-Lys). In the PEG-bound form the IL-2 is inactive, but In vivo the PEG chains are released slowly which provides a more controlled release of active IL-2 peptide [4] (the IL-2 conjugates with 1 or 2 PEG chains are the most biologically active conjugates [3]). This prodrug strategy mitigates against the severe side effects which limit maximal dosing of parental aldesleukin.
Click here for help
Peptide Sequence Click here for help
PTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLR
PRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFSQSIISTLT
Post-translational Modification
Disulphide bond between cysteine residues at positions 57 and 104.