GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

Pi-hexatoxin-Hi1a   Click here for help

GtoPdb Ligand ID: 10306

Synonyms: π-Hi1a | π-HXTXHi1a | pi-Hi1a
Compound class: Peptide
Comment: Pi-hexatoxin-Hi1a is a peptide toxin isolated from the venom of Hadronyche infensa (Fraser island funnel-web spider).
Click here for help
Peptide Sequence Click here for help
NECIRKWLSCVDRKNDCCEGLECYKRRHSFEVCVPIPGFCLVKWKQCDGRERDCCAGLECWKRSGNKSSVCAPIT
Asn-Glu-Cys-Ile-Arg-Lys-Trp-Leu-Ser-Cys-Val-Asp-Arg-Lys-Asn-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Tyr-Lys-Arg-Arg-His-Ser-Phe-Glu-Val-Cys-Val-Pro-Ile-Pro-Gly-Phe-Cys-Leu-Val-Lys-Trp-Lys-Gln-Cys-Asp-Gly-Arg-Glu-Arg-Asp-Cys-Cys-Ala-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Ser-Gly-Asn-Lys-Ser-Ser-Val-Cys-Ala-Pro-Ile-Thr