From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

tadekinig alfa   Click here for help

GtoPdb Ligand ID: 10077

Immunopharmacology Ligand
Compound class: Peptide
Comment: Tadekinig alfa is recombinant IL-18-binding protein in its mature form without the 30 amino acid signal peptide of the precursor protein (NP_001034748). It is being developed by AB2Bio.
Peptide Sequence Click here for help
TPVSQTTTAATASVRSTKDPHCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEH
LPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSS
PQQQG